SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297560220|ref|YP_003679194.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297560220|ref|YP_003679194.1|
Domain Number 1 Region: 199-483
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.92e-49
Family Diacylglycerol kinase-like 0.0033
Further Details:      
 
Domain Number 2 Region: 4-177
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 2.35e-27
Family Type 2 phosphatidic acid phosphatase, PAP2 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297560220|ref|YP_003679194.1|
Sequence length 489
Comment PA-phosphatase-like phosphoesterase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MSRLQRADKKVYDHVTGLGPASLDAYTPKFVQATDNMAPWFLMSATLAATGGPRLRRTAL
RAILAAGTANLVSAGIKQISGRTRPDNSAVPAARSPYRSYPSTSFPSGHTAAAAAYAAGV
MTDAPKPLAGLVALLAGGVAFSRVHSGVHYPGDVLAGVAIGCGAALLAGTVVPPRPELVF
GARTVADGETDVDREGGGVTVVVNPRSASGTVPGLTAADVTSRVARALPKARIIPLSADD
DVVGVMDQAARTSEVLAVAGGDGTVNAGAQAALDHDRPLLVLPDGTLNNFARTLGLSSVD
IALRAFDDGRLARVDVGEVDGRIFLNTSSFGSYPRMVDRRDKWAERIGKWPAFALALWQD
LREVSPISAVVDGEPAKVWWAFVGNCQYRTHGRVPALREQLDDGRLDVRVLTARAPFPRL
RAVADVLLGKFAHGEGYSERLTTGLTLTIPGEPRLLAVDGEVVEGSRTVVFTKRHAALRV
FVPAVETDR
Download sequence
Identical sequences D7B2J0
WP_013152295.1.70090 WP_013152295.1.87825 gi|297560220|ref|YP_003679194.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]