SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297560509|ref|YP_003679483.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297560509|ref|YP_003679483.1|
Domain Number 1 Region: 6-258
Classification Level Classification E-value
Superfamily Cgl1923-like 1.57e-81
Family Cgl1923-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297560509|ref|YP_003679483.1|
Sequence length 279
Comment hypothetical protein Ndas_1548 [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MTKLVRELVDPVMVAAFEGWNDAGEAASLAVEHLSREWDAYELCALAPDDYYDFQVTRPR
MSIVDGVVGEVEWPTTRVRVATPPGSERDVVLVTGPEPNMRWRSYAADLLAVARELGVTR
MVMLGSLLADAPHTRPIPVTGMASPVELGSALGLEATTYSGPTGIVGVVHEAFSAVGIET
ASLWAAIPHYVAQPPCPKASLALLAWVEDFLGARVPLGDLPEDAVAWESNVNELTAEDED
IAAYVRGLEEAKDTADLPEASGDAIARDFERYLRRHDEG
Download sequence
Identical sequences A0A223QC48 D7B416
gi|297560509|ref|YP_003679483.1| WP_013152584.1.62139 WP_013152584.1.70090 WP_013152584.1.87825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]