SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297560567|ref|YP_003679541.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297560567|ref|YP_003679541.1|
Domain Number 1 Region: 88-335
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 9.37e-59
Family BC ATP-binding domain-like 0.00001
Further Details:      
 
Domain Number 2 Region: 1513-1823
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.24e-36
Family Biotin dependent carboxylase carboxyltransferase domain 0.00061
Further Details:      
 
Domain Number 3 Region: 335-450
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 3.35e-36
Family BC C-terminal domain-like 0.00013
Further Details:      
 
Domain Number 4 Region: 1-118
Classification Level Classification E-value
Superfamily PreATP-grasp domain 7.87e-33
Family BC N-terminal domain-like 0.00015
Further Details:      
 
Domain Number 5 Region: 1293-1499
Classification Level Classification E-value
Superfamily ClpP/crotonase 6.75e-22
Family Biotin dependent carboxylase carboxyltransferase domain 0.0031
Further Details:      
 
Domain Number 6 Region: 580-655
Classification Level Classification E-value
Superfamily Single hybrid motif 0.00000000000000537
Family Biotinyl/lipoyl-carrier proteins and domains 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297560567|ref|YP_003679541.1|
Sequence length 1827
Comment carbamoyl-phosphate synthase L chain ATP-binding protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MFSRVAIVNRGEAAMRLIHAVRDLSAETGTRIETVALHTDADRDATFVREADVAYSLGPA
SARPYLDHAVLERALVQTGADAAWVGWGFVAEDPAFAELCERIGVTFVGPSAEAMRKLGD
KIGAKLIAEEVGVPVAPWSRGEVATLEEALRAGEEIGYPLMLKATAGGGGRGIRMVASGE
DLAEAYERTSQEALRAFGSGVVFLERLVTGARHVEVQIIADGQGTAWALGVRDCSVQRRN
QKIIEESASPVLDAEQTAHLKASAERLALAVDYRGAGTVEFLYHPGEKLFAFLEVNTRLQ
VEHPITEITTGTDLVRLQLHVASGGRLEGPQPVESGHAVEARLNAEDPDRDFAPAPGRIA
RLVLPSGPGVRVDTGVREGNTIPADFDSMIAKVIAYGRDREQALARLRRAMAETTVIIEG
GATNKSFVLDLLDQPEVIDASADTGWIDRVRAQGRLVSHRHSAVALAAAAIEAYQDEEEV
SRQRLLSTAHGGRPQVQHESGRPLDLKLRGVGYRVSVARVGHRRFRVGVSGGGDVHPADV
EVERFDAHSGQIVVNGHRFRLVSATHGPVHLVEVDGVTHRISRDEGGVLRSPAPALVVAT
PLAVGDEVESGAPVLVLESMKMETVLRAPFRARVRECPVSVGSQVETGAPLMRLEPLSDG
DAEEAESGSEAVAIELPEEAGEASAAERVERGLQDLRGLLLGFDADPHDRGRVLADYLVA
RAEMGGRPVEGELDLFTVFADLCELSRNKPGGEPDTEPHSSVHSPREFFHSYLQSLDVER
AGVSEGFQAKLTRVLAHYGVSDLDRTPELEAAVFRIFLAQQNTGAALAIVSELLRRWLAG
GPPAEALSERAGLALEHLVEATQVRFPAVSDLARGVVFRWFAQPLLRRNRARVYAAVRDD
LRHLDRDPDAPDRAERIQAMVASAEPLVRLVGQRMGRAGRDHAPLLEVLTRRYYGNRGLS
GVAAREVGGCRFVTAEHNGAGGLTRVVTTAVDIAALPDALGAVGELAADVAERGLVADLY
LTWEGQPDADAMAVRLGGLLAEHPLPAGVRRVTATVAGTSGAVMHHHFTFRPEGDGFVED
RLIRGLHPQIARRLQLQRLREFDLTRLPSADEEIYLFRAVAKSNPADERLFAMGQVRDLT
PLREADGRLIALPALEDTVTGCLDAIRNIQAQRPQNRRFDTNRIMMYVWPATELTPEELD
TLVQRLLPTTAGAGLEEVQFLARQRTSSGELTEVAVRISLDQGQDARVHVEEPSTEPVLP
LDDYRQKVLRAARRGTVYPYELTGLLSGPGGGFTEYDLDDNGVLVPVDRPRGHNSAAIVA
GVVTTPTVRHPEGVTRVVLLGDPTKALGALSEPECSRVIAALDLAESMRVPLEWFALSAG
ARISMSSGTENMDWVAAALKRIVEFTQDGGEINIVVAGINVGAQPYWNAEATMLMHTKGI
LVMTPDSAMVLTGKQSLDFSGGVSAEDNFGIGGYDRVMGPNGQAQYWAPNLASAREILMA
HYDHTYVVPGEEAPRRARTLDPVDRDVSAFPHAVAGSDFATVGEIFSAEHNPDRKKPFDI
RTVMRALSDQDHAVLERWAGMADADTAAVQDVHIGGWPVCLVGIESRSVPRHGFPPTDGP
DTYTAGTLFPRSSKKVARAINAASGNRPLVVLANLSGFDGSPESLRKLQLEYGAEIGRAI
VNFDGPIVFCVISRYHGGAFVVFSKALNPNMTVLALEGSFASVLGGAPAAAVVFAGEVNT
RTASDPRVTGLQEQVSAASGAERAALNARLAETQSSVRAEKLGEVAAEFDRVHSIQRAVE
VGSVDAIISAAEMRPRIIEAIEHGMKR
Download sequence
Identical sequences D7B474
WP_013152642.1.70090 gi|297560567|ref|YP_003679541.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]