SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297560576|ref|YP_003679550.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297560576|ref|YP_003679550.1|
Domain Number 1 Region: 10-173
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.0000000000000912
Family Hypothetical protein TT1808 (TTHA1514) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297560576|ref|YP_003679550.1|
Sequence length 197
Comment hypothetical protein Ndas_1615 [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MTVADHHPPPTHPSVTVQQFEPIALAAEREDVKLEYVNGKIWAEGVTDGDHNSILTWLFR
QFMAHRPDLDLTQGQGLKVDTYRNGRARPDGILTPVGYFDGQGEWAEPDGVLAVIEVTSW
DADTHARDRVEKPAAYAATEIPAYLLVDRDVNAVVVHSRPEHGEYQDRSRHVYGDRVEIP
GTGIILDTDELKSRFAR
Download sequence
Identical sequences D7B483
WP_013152651.1.62139 WP_013152651.1.70090 WP_013152651.1.87825 gi|297560576|ref|YP_003679550.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]