SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297560933|ref|YP_003679907.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297560933|ref|YP_003679907.1|
Domain Number 1 Region: 11-109
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.36e-18
Family DNA-binding N-terminal domain of transcription activators 0.0075
Further Details:      
 
Weak hits

Sequence:  gi|297560933|ref|YP_003679907.1|
Domain Number - Region: 126-261
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.00011
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297560933|ref|YP_003679907.1|
Sequence length 283
Comment MerR family transcriptional regulator [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MSTPPPREGLSRGEFARASGLSPKALRLYERSRLLVPHRVGAGGHRVYLAAQVERARSIR
LLRQMDMPLAVVAEVMAQEGGQALERAEAWWRAQEEALRSRRAALAELRLSWGGAAERAP
EPVWRVRGEHVAAAKVAAVRVRTDQQNLVATLHGRARALRRLLVGQGARPGPGFWVVYHG
AVTPDGPAPIEVAVPFTGQAEPEGETVIRVEAAHVRAVCEVRRGDCFYPRIMGAYRAVER
WMLQRGAHAAGPLREVYEASWDEVDRDAVFALVARPMRQAGRG
Download sequence
Identical sequences D7B6D6
WP_013153008.1.70090 WP_013153008.1.87825 gi|297560933|ref|YP_003679907.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]