SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297561075|ref|YP_003680049.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297561075|ref|YP_003680049.1|
Domain Number 1 Region: 21-166
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 5.36e-20
Family Hypothetical protein TT1808 (TTHA1514) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297561075|ref|YP_003680049.1|
Sequence length 201
Comment hypothetical protein Ndas_2118 [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MPVSPVAERQSSTGSRYEPLTPPPEGFTADDLDSIPDLPPHTELIDGSLVLVTPQRNFHT
VVLSVLDTRLFEQAPDRLRVRREMTLKLGPRQRPEPDLILVQAQATGGTEQTWFAPEAVE
LVVEVVSPESELRDRERKPQLYAEAGIPNFWLIEQDRGEAVVYVHELAPTGGYTRPTVHR
QRLKTSRPFPVDIDLTEIQRR
Download sequence
Identical sequences D7B7H1
gi|297561075|ref|YP_003680049.1| WP_013153150.1.70090 WP_013153150.1.87825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]