SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297561083|ref|YP_003680057.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297561083|ref|YP_003680057.1|
Domain Number 1 Region: 126-288
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.00000000000419
Family Rob transcription factor, C-terminal domain 0.09
Further Details:      
 
Domain Number 2 Region: 55-107
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000896
Family AraC type transcriptional activator 0.017
Further Details:      
 
Domain Number 3 Region: 3-53
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000034
Family AraC type transcriptional activator 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297561083|ref|YP_003680057.1|
Sequence length 290
Comment transcription activator effector binding protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MLDRLNRALEKVEEDTGRPVDVAEMARIALTSEHHLRRLFSALAGMPLSEYVRRRRLTLA
GAEVLGGGDSLLDIAVRHGYGSAEAFARAFRAMHGVGPGEARRTGAVLVSQPRMSFRLTV
EGSTTMRYRIVDKEAFRLVGPKARVPIVHEGRNHAMEEFVRSLDKGVRARVAELSDQEPR
GVLGVTAALSPDRGEGSLIDYYEAAATSARGAEGMEALEVPSGTWVVFPKSVPVERCPEG
LQHMWADAFGRWFPSNTAYRVTEGPEILRVSYTEDGATAEAELWLPVERL
Download sequence
Identical sequences D7AUH1
WP_013153158.1.70090 WP_013153158.1.87825 gi|297561083|ref|YP_003680057.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]