SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297561690|ref|YP_003680664.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297561690|ref|YP_003680664.1|
Domain Number 1 Region: 104-197
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 2.36e-17
Family MRR-like 0.018
Further Details:      
 
Weak hits

Sequence:  gi|297561690|ref|YP_003680664.1|
Domain Number - Region: 40-104
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00196
Family Glycerol-3-phosphate transporter 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297561690|ref|YP_003680664.1|
Sequence length 222
Comment restriction endonuclease [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MTDISPDDATEDRTYPDMTYPDEGRRGPREWRFVWRHRYALVLGLVVALMVGAWVAQSSA
RPLLWAVAALGVAALLWWCRMRLRLAREKWRVARVDLSEVDRMTGVEFEEHVAGLMRTHG
YTAVTVVGGADDGGVDVLGRAPDGQAVVVQCKRWNSPVPPNEVRAFLGVLATSYEGYRGV
FVASNGFTEAAAREGEGYMTLVDRERLARWMGGSGAPEPPPA
Download sequence
Identical sequences D7AZN7
WP_013153765.1.70090 WP_013153765.1.87825 gi|297561690|ref|YP_003680664.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]