SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297561788|ref|YP_003680762.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297561788|ref|YP_003680762.1|
Domain Number 1 Region: 100-239
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 4.89e-22
Family Tetracyclin repressor-like, C-terminal domain 0.0067
Further Details:      
 
Domain Number 2 Region: 15-88
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000324
Family Tetracyclin repressor-like, N-terminal domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297561788|ref|YP_003680762.1|
Sequence length 260
Comment TetR family transcriptional regulator [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MAKPQLDRVAGGPSRRERVREATLAEIKGIARRHLVEHGSGGVSLRAIAREMGMTAPGLY
RYVTGIDALLVLITADMFQELGDAVAAADASVPAEDTDLRILTSLRAFRAWAIGHRAEFA
TMFGPRVRLAPETDVTPAVEAGRRFGATFYTLFDRLLSEERFVLPDGDRITPELARDLRA
FADTCGFSAPHIPVEAVMVLSTCWVRLYGVVCMEVFEHLDFVMRDMEPLFESELQNMLTG
LGVRYRPPESSAPTTMGTSG
Download sequence
Identical sequences D7AZY5
gi|297561788|ref|YP_003680762.1| WP_013153863.1.70090 WP_013153863.1.87825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]