SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297561831|ref|YP_003680805.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297561831|ref|YP_003680805.1|
Domain Number 1 Region: 418-667
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.83e-68
Family Acylamino-acid-releasing enzyme, C-terminal donain 0.011
Further Details:      
 
Domain Number 2 Region: 15-142,173-405
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 3.27e-34
Family DPP6 N-terminal domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297561831|ref|YP_003680805.1|
Sequence length 678
Comment peptidase S9 prolyl oligopeptidase active site domain-containing protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MVRSWYELPEYVRLRRVNGLRLSPDGTRLVAPVSGPAPDAKSFRSALWEIDTAPESEGGR
APRRLTRSAKGESGVGFLPDGSVLFTTGRPDPEAEADAKARTALWLLPADGGEARQVASR
PGGIGSFTVARDSGLVALTADTLPRSEDEEADREARKAREEAGVTAILHEALPVRSWDSD
IGPGHPRYLVAEPPADEDSRLGDPRDLTPDAGMALLGASGDLTPDGTTLVTEWQVPVGRG
ARRTDVVAIDTATGRRRTLATDPAHDFDSPLVSPDGRHVLLVRSSQGDYDGEPRDETAWL
VDLATGQGRDLLADHELWPRELAWAADSGAVFLVADHGGRRPVFRIDLASGALTRVTGDH
GAYSNLNPSPDGRHVYALRDAWDAPPAPVRLAADAADGQPVHLRTPGSELTMPGTLTEIE
ATADDGTPIRSWLVLPEEASADSPAPLMLWVHGGPYMSFNGWSWRWNPWLLAARGYAVLL
PDPALSTGYGQDMLRRAWGQWGPRTFADVMAVTDAAEAREDIDAERTAMMGGSFGGYMAN
WIAGHTDRFRAIVSHASLWGLDGFNGTTDYPPVWEREFGTPLERPERYTLNSPHLHADRI
RTPMLVIHGDKDYRVPISEGLRLWRDLMLHEVDAKFLYFPDENHWILTPGNARIWYETVF
AFLDHHVHGKEWSRPELL
Download sequence
Identical sequences D7B0R4
gi|297561831|ref|YP_003680805.1| WP_013153906.1.70090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]