SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297561968|ref|YP_003680942.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297561968|ref|YP_003680942.1|
Domain Number 1 Region: 6-301
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 7.59e-75
Family NAD kinase-like 0.0000000991
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297561968|ref|YP_003680942.1|
Sequence length 308
Comment ATP-NAD/AcoX kinase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MTSGRSVLLLAHTGRPAAVRSAQLVHESLSRAGLTVRMLKNEIEELAAEDCVLSPVEVVE
PGEAARGVELVMVLGGDGTLLRAAEIARPAGAPLLGVNLGHVGFLAEAEREDLGATVRSV
VNRDYDVEERMTLDVAVFNGGRGDGSPPVRNWALNDATLEKGEARRILETVLEIDGRPLS
RWACDGVVCATPTGSTAHAFSAGGPVVWPDVDALMVVPLSAHALFARPLVVGPNATVALE
VVPATAPGVLWCDGRRMVELPAGARIEITRADTPVRLARLHRAPFTDRLVAKFGLSVAGW
RGRSEHGR
Download sequence
Identical sequences A0A223QFP4 D7B1L0
gi|297561968|ref|YP_003680942.1| WP_013154043.1.62139 WP_013154043.1.70090 WP_013154043.1.87825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]