SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297562093|ref|YP_003681067.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297562093|ref|YP_003681067.1|
Domain Number 1 Region: 2-203
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 1.44e-58
Family Ribosomal protein S4 0.000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297562093|ref|YP_003681067.1|
Sequence length 203
Comment 30S ribosomal protein S4 [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MRYTGPKVRLSRRAGTPLTRKAVSYFEKRPYPPGEHGRRVRRNSSDYAVRQAEKQKVRWY
YDLTEKQMLRVYESAKKRTGRTGEEMLAELELRLATVVLRAGLAASIYAARQFVNHGHIT
VDGKKVDIPSYQVKPGQIISVREKSRNMVPFVEAAEGVHADDKIAGFLAVSHKDLRVAVV
DRPKREQIPVPFDEQLVVEFYAR
Download sequence
Identical sequences A0A223QFU4 D7B2A4
gi|297562093|ref|YP_003681067.1| WP_013154168.1.62139 WP_013154168.1.70090 WP_013154168.1.87825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]