SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297562200|ref|YP_003681174.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297562200|ref|YP_003681174.1|
Domain Number 1 Region: 16-197
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 4.05e-53
Family Oxidoreductase molybdopterin-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297562200|ref|YP_003681174.1|
Sequence length 199
Comment oxidoreductase molybdopterin binding protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MNVVSRGFQGRRGGDPSRVPPGQYETHDFPVLSAGPTPHVDTAEWTFAIADEAGGTRSWT
WDEFLDLPQERLRVDIHCVTRWSKLDTDWAGVSVDTLLEDVETAAEYALAVSHGGYTANL
PLQDLTDGRAWVVHSFGGEPLAPEHGGPARLLVPHLYFWKSAKWVRGLRLLDEDEPGFWE
QAGYHDYGDPWREQRYQGD
Download sequence
Identical sequences D7B2X8
gi|297562200|ref|YP_003681174.1| WP_013154275.1.70090 WP_013154275.1.87825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]