SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297562392|ref|YP_003681366.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|297562392|ref|YP_003681366.1|
Domain Number - Region: 570-623
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.0706
Family DPP6 N-terminal domain-like 0.023
Further Details:      
 
Domain Number - Region: 25-113
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0863
Family Apolipoprotein A-I 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297562392|ref|YP_003681366.1|
Sequence length 842
Comment hypothetical protein Ndas_3457 [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MASFDLSLTLRTTDAIPALIRARTTDFEELDARVLGDSENLQASLDGAAGQFTSILAWDI
STLAAEDQQLWVDAAVALTYAADVSDMWADYVEEFRDGREELLEEWHSAVTDREGRVPGE
YASSHITLTFPERKGFWSDENTCRDLYDELVEKRTSIQGRFDTLWTIYQEHVEEIGDMLE
EGATKVNVQKLIDGGHANWAYYNLDPNHYTMLVDGRELTEENAQEWAGELSEYWSGDKPI
DDRYHELMIMLGMITTNAMQAQQGGTGYREEEMDFLKTFYAELEEGNHNGVIGIPDQMEL
GQFSQDNREHALGILGDGLLALSDHRLGGGYYDLPESVQFAAEEGFLMASGGGASGYGTN
SLAELLRYTSDDMEAGYGLSNTLTMSMGMFAASDAVEGMNHSEDDITALLDVSTRNRDAN
HDLLTGEYVHPLFADTEKVDGETTYPTLEANGFDTPQGMIDHVLEGLFTYDWNDDGESAS
GLFDWIAEDTMNGTPEEQERAGHAAAGFIETVTRPELFAAFTGVENTDGGADIPMGEVNP
DVALSMAEVFHAYVDDFGVGTQESEGAQFHTDASPNQFAFAPDGNVLLVGDMNRVRFMEL
VMGDTEAASNMYASIEGRNAIVLNDALENGEFSEETVRSGGRLTNLFESAFDNYATGRYG
LGEEAYQQEIDIKKRGWGVVIGSVAGPIPYAGGLVGDGGKEIANHLIESNADIYSSLSDV
EGEVSGEDIPQYSRDVLHLDIQLQLVNDMVERGEIDPSSLPEEILREDGSVARSYEEVDA
RGSSPSSFNELVADEVLDGDSEKLAREYAEQFDDGNSSFAGGNLRADDTTEYDTHINPER
RN
Download sequence
Identical sequences D7B3U3
WP_013154467.1.70090 gi|297562392|ref|YP_003681366.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]