SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297562750|ref|YP_003681724.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297562750|ref|YP_003681724.1|
Domain Number 1 Region: 44-426,454-538,583-740,782-825
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.08e-108
Family Tandem AAA-ATPase domain 0.000017
Further Details:      
 
Domain Number 2 Region: 983-1125
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.000000965
Family Exodeoxyribonuclease V beta chain (RecB), C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297562750|ref|YP_003681724.1|
Sequence length 1150
Comment UvrD/REP helicase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MSETHPHPHPRRSPSRPHPEPEPAPAPPPRFSPPELARLLGQPEPTAEQSEVICAPLEPG
VVIAGAGSGKSETMASRVVWLVANGHVRPEQILGLTFTRKATAELAERVRKRLEQLRATE
QLPEELLDGEPTVSTYNAYAGRIVADHALREAVEPTSRLLSEGQAWQIAARVVGEYDGPM
DLITVGADTVTRRVLELSGQIADHLTTTEQVRGIGRWLRAAVDALPRKPAVPTRNLLNAQ
LRREQLLPLVEGYEHAKHVREAMDFGDQVSLAARIAQNHPEVGLIERGRFRVVLLDEYQD
TSHAQLVLLRALFGEGHAVTAVGDPCQSIYGWRGAIAANLANFPNDFPAAPGRAASVRRL
ATSFRNGERILEVAKHISEPLRAESAEVPVLYPGPARRGRGAVRTGLFIGQREEARWIAE
QVAGYLRAAPGRAGSATTAPDGLPWPPGESGGAADGGVSPGDVAVLCRKRSQFPAIREAL
EELDIPVEVVGLGGLMMVPEVRDIIATLRVVHDASAGNELARLLTGPRWRIGPRDLAALG
ARAAELARQTRRDLTGPEPDQSAEDDILRRTVLDLTAESGSLVDAVDDPGPAERYSATAY
ERLGRLAEELRSLRKLVGQPLPDLVTETERMLGLDIEVGARSGRDPLSARADLDAFVDHA
VRFAGSSEDPTLGSFLSYLRAASERESGLAPGERVGGSDTVKLMTVHASKGLQWPVVVVP
GVSGGKYAPLFPTSLSEGDMWIKGEHLLPYRLRGDRQNLPELLAVDKKGIEAFKEAERER
HLLEERRLAYVAVTRASFALLCTGHWWGTDAASERGPSPFLEEIRLACEGGAGEVAHWEP
RPDPDDNPYEEEDDGTAVWPPQEDDGSGPPEEGAEPDRPRDRRAQIAEGAAMVERARARL
LAGEADPAEEAAPPPGLRRRIGGWERDTELLLAHRRAEGPGSGDGTVQVELPAHLSVSSM
VWLARDPSALARQIRRPLPRPPAPHTRRGTAFHAWLEQRFGQRAALLDELPGAADETAGQ
DEDLADLQSRFEESEWGSRVPVEVEVPFETVIGDRLVRGRMDAVFHDPASGRYDVVDWKT
GSPPGNGPERRAVGVQLAAYRLAWADLAGVSLEEVSAAFHYVRAGLTVRPADLLDAEGLA
ALIDAVPEPG
Download sequence
Identical sequences D7B5X5
gi|297562750|ref|YP_003681724.1| WP_013154825.1.70090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]