SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297563153|ref|YP_003682127.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297563153|ref|YP_003682127.1|
Domain Number 1 Region: 117-304
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.15e-19
Family Phosphate binding protein-like 0.0035
Further Details:      
 
Domain Number 2 Region: 15-97
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000245
Family LysR-like transcriptional regulators 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297563153|ref|YP_003682127.1|
Sequence length 305
Comment LysR family transcriptional regulator [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MSAKARGTVQLRGIEIRELECFLVLAEEPHPGHAAVRLGVPAETVDLLLRALEDRIGAPL
LDRTGPRPCLTPFGEEFLDALRPAYQNLAAVVDGARDRAHGGPSTVRLGFRGKVHGPVAE
AVRAFEEREPGTRVRIVETAHSDPFGPLREGEVDAAVVLLPVRELDLVVGAVFSRQPQRL
ALPADHPLAARTGVGIEDMARVSLIPVRRTPDHWLRVHAPTVTPLGRTIRHETGVDTLRE
GFSQIAAGRGAMLLSGDVADHADRDGLVLVPVNGLPESSLGLVWPRGDRHPSVPVLAAAL
ADALG
Download sequence
Identical sequences D7AVW1
WP_013155228.1.70090 gi|297563153|ref|YP_003682127.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]