SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297563302|ref|YP_003682276.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297563302|ref|YP_003682276.1|
Domain Number 1 Region: 5-246
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.18e-57
Family ABC transporter ATPase domain-like 0.0000612
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297563302|ref|YP_003682276.1|
Sequence length 259
Comment phosphate ABC transporter ATPase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MAKRIDVSGLHVYYGDFKAVEDVSMTIEPRSVTAFIGSSGCGKSTFLRTLNRMHEVTPGA
RVQGKVLLDDLDIYGPDVDPVMVRSEVGMVFQKANPFPTMSIYDNVIAGARLNNRRMSKS
EADELVEGSLRGANLWEEVKDRLNKPGSGLSGGQQQRLCIARATAVKPSVLLMDEPCSAL
DPISTLAIEDLIHQLKENYTIVIVTHNMQQAARVSDRTAFFNLSAPGKPGKLIEMGETNQ
MFTRPEKKETENYITGRFG
Download sequence
Identical sequences A0A223QJJ6 D7AX00
gi|297563302|ref|YP_003682276.1| WP_013155377.1.62139 WP_013155377.1.70090 WP_013155377.1.87825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]