SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297563486|ref|YP_003682460.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|297563486|ref|YP_003682460.1|
Domain Number - Region: 5-78
Classification Level Classification E-value
Superfamily Triger factor/SurA peptide-binding domain-like 0.00129
Family Porin chaperone SurA, peptide-binding domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297563486|ref|YP_003682460.1|
Sequence length 121
Comment hypothetical protein Ndas_4567 [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MAEHDPAVDEAWEEFHAVVNMTGEQLREWLLTNASGEDAFRTEPGHTVSRRGEAVVNLLN
KRRVDVTESDVELMREVTEYVRGQLADPHREDARWRHRLMSVGHDPLSPDSARPDEEDLA
G
Download sequence
Identical sequences D7AY76
gi|297563486|ref|YP_003682460.1| WP_013155561.1.70090 WP_013155561.1.87825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]