SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297563666|ref|YP_003682640.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297563666|ref|YP_003682640.1|
Domain Number 1 Region: 12-139
Classification Level Classification E-value
Superfamily CheY-like 8.54e-31
Family CheY-related 0.0014
Further Details:      
 
Domain Number 2 Region: 144-218
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 4.42e-19
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297563666|ref|YP_003682640.1|
Sequence length 223
Comment LuxR family transcriptional regulator [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MPGGGAEGVRKRIRVFLVDDHEVVRRGVAALLETEDDMTVVGEAGTAEQALSRIPVVLPD
VAVLDVRLPGGSGVQVCREIRSDHPEIACLMLTSFADEDALYDAVMAGAAGYVLKQIHGA
DLVGAVRTVASGGSLLDSGSTGAMLERLRGAQAEPDPLAELTPQERQILDLIGEGMTNRQ
IGERLYLAEKTVKNYVSALLSKLDLKRRTQAAVLVAELRGRRY
Download sequence
Identical sequences A0A223QKG6 D7B046
gi|297563666|ref|YP_003682640.1| WP_013155741.1.62139 WP_013155741.1.70090 WP_013155741.1.87825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]