SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297563779|ref|YP_003682753.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297563779|ref|YP_003682753.1|
Domain Number 1 Region: 115-160
Classification Level Classification E-value
Superfamily R3H domain 0.00000000000902
Family R3H domain 0.0073
Further Details:      
 
Weak hits

Sequence:  gi|297563779|ref|YP_003682753.1|
Domain Number - Region: 56-104
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0986
Family Eukaryotic type KH-domain (KH-domain type I) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297563779|ref|YP_003682753.1|
Sequence length 162
Comment single-stranded nucleic acid binding R3H domain-containing protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MAEAPEAGIDVEALENEGDIAADYIEGLLDIADFDGDIDMDVEGDRAMVSVVGATLDELI
GEKGEVLEALQELTRLAVHRATGERSRLMLDIGGYREDRRKVLFQVGTDAANKAKETGQT
QPLEPMTPFERKVVHDAVAAAGLHSESEGEEPHRYVVVRPAP
Download sequence
Identical sequences D7B153
gi|297563779|ref|YP_003682753.1| WP_013155854.1.70090 WP_013155854.1.87825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]