SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297563831|ref|YP_003682804.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297563831|ref|YP_003682804.1|
Domain Number 1 Region: 84-201
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 3.4e-21
Family Tetracyclin repressor-like, C-terminal domain 0.005
Further Details:      
 
Domain Number 2 Region: 2-81
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000359
Family Tetracyclin repressor-like, N-terminal domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297563831|ref|YP_003682804.1|
Sequence length 206
Comment transcriptional regulator, TetR family [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MARTADHEERRRQVARALLSTVGERGLARTTLADVADRAGVSVGLVQRYFRTKSQLLRFG
VEYLYKQGADRLTAVNTDGPPIASARDWVSRAARTLLPLDDERRAELTVWLEFLPATMTD
PEMSRLHKDTTAELVGVFTQVMDEAVRRGELPPGTDTAAEAAGLVALVDGLTVHHLITGD
DAFSESAVRAALATHLDRLFPAPERP
Download sequence
Identical sequences D7B7Z0
gi|297563831|ref|YP_003682804.1| WP_013155905.1.70090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]