SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297564075|ref|YP_003683048.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297564075|ref|YP_003683048.1|
Domain Number 1 Region: 11-186
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 5.04e-17
Family Hypothetical protein TT1808 (TTHA1514) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297564075|ref|YP_003683048.1|
Sequence length 197
Comment hypothetical protein Ndas_5162 [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MTAEPLPDWFMPPPGGWTADDMDNLPPGVPRMELIDGALVLLSPQTRFHAKVMIRLAARL
EEAAPPNVDVLSEMTMKLGKRQRPEPDLIVYEFAEGAEEHLDWYQATHVPPEDVLLTVEI
VSKESQDRDRSTKPLKYAQAGIPHFWRIEHEENGPAVYVYELDGTKEPRYIPVTVARERL
KLDLPFPIDIDVRALSR
Download sequence
Identical sequences A0A223QKX9 D7B8N4
WP_013156149.1.62139 WP_013156149.1.70090 WP_013156149.1.87825 gi|297564075|ref|YP_003683048.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]