SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297564220|ref|YP_003683193.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297564220|ref|YP_003683193.1|
Domain Number 1 Region: 229-251,283-678
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 8.45e-91
Family beta-Lactamase/D-ala carboxypeptidase 0.002
Further Details:      
 
Domain Number 2 Region: 52-272
Classification Level Classification E-value
Superfamily Lysozyme-like 1.21e-66
Family PBP transglycosylase domain-like 0.0000199
Further Details:      
 
Weak hits

Sequence:  gi|297564220|ref|YP_003683193.1|
Domain Number - Region: 699-759
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0183
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297564220|ref|YP_003683193.1|
Sequence length 789
Comment glycosyl transferase family protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MLQRISQLVGVGVVAGLLVAALALPAVGGLGITARNVASGFLEMPSNLETPPPPQRSTIY
DSEGGVIAEIFDQNRELVEIEDVSPVMIDAILAIEDAHFYEHGGMDVSGTLRAALRTLSG
DTQGASSITQQYVKNVQIEAATTQEELEEASETTIARKIRELRYAVALEQRMTKDEILEG
YLNIAYFSDGAYGVESAAQHFFQVPASDLELHQAATIAGLVRYPYLYNPRFFPEQTTDRR
NVVLDRMVATGAITEAEAEEAKQVPMEVEISTPPNGCVPSDQPFFCDYVVQEIEKDERFG
QNETERARWLRTAGLQIHTTLDPQTQVSAQEAVDEWVPRENESRKVAAEVVIQPGTGHIL
GMVQSRNYGPDESKLGETSINFATDADRGGSSGFQAGSTFKAFTLAAALAEGMPFGTSFN
SPASVTVSGQRSCNGGTLSPWSPSNSGDTNSNTTHNMMTGTRASSNTYFAQLQARVGFCD
VMEMAENLGLRRADGTLFTENERSLANSSFTLGSEEVSPLRVANAYSVFASGGILCEPQA
ITKIIDQHAHETIEIEPECERVIDEEVADGVSYLLEQPFNGGTAASLGIGRPAAGKTGTT
DGSAAAWFAGFTPQMAGAVFVGDPRGPQQYPLRNVTIGDRYYGVVYGATIPGPIWQETMR
GAHEGLDVEQLPSPPSQFGSTSAPRTEEEASPASDDGGVPDVIGRSEQEAVSVLEAAGYT
ANVSATRVRSPEPEGTVAAVNPDPGTRLPEGATVNVFLSSGGGTASGPEDDEDWFPVAPA
SNSPGREDD
Download sequence
Identical sequences D7B929
gi|297564220|ref|YP_003683193.1| WP_013156294.1.70090 WP_013156294.1.87825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]