SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297564293|ref|YP_003683266.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297564293|ref|YP_003683266.1|
Domain Number 1 Region: 4-210
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.62e-62
Family Phosphate binding protein-like 0.000000507
Further Details:      
 
Domain Number 2 Region: 211-283
Classification Level Classification E-value
Superfamily GlnB-like 4.67e-22
Family ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297564293|ref|YP_003683266.1|
Sequence length 284
Comment ATP phosphoribosyltransferase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MPDMLRIAVPNKGQLSEPAVEMLREAGYRQRKSSRDLVMIDPDNDTEFFFLRPKDIAVYV
GEGILQAGITGRDMLLDSGAAVDEVLPLGFGGSTFRFAAPGGAGMKVSDLNGKRIATSFD
GLLRSYLDEQGVDARVIHLDGAVESSVQLGVADAVADVVSTGTTLRQAGMETFGEPILVS
EAVVIRPSGAPENPRFDTLLRRLRGVLVARDYVMMDYDVHAERLEAAVALTPGMEGPTVS
PLHREGWVAVRSMVPSKDAQRIMDDLWQLGARAILVTDIYACRL
Download sequence
Identical sequences A0A223QKK9 D7B9A2
WP_013156367.1.62139 WP_013156367.1.70090 WP_013156367.1.87825 gi|297564293|ref|YP_003683266.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]