SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297561854|ref|YP_003680828.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297561854|ref|YP_003680828.1|
Domain Number 1 Region: 7-329
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 1.57e-114
Family Tex N-terminal region-like 0.0000000341
Further Details:      
 
Domain Number 2 Region: 330-478
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.17e-49
Family Tex RuvX-like domain-like 0.00000108
Further Details:      
 
Domain Number 3 Region: 479-567
Classification Level Classification E-value
Superfamily RuvA domain 2-like 1.22e-26
Family Tex HhH-containing domain-like 0.000088
Further Details:      
 
Domain Number 4 Region: 647-735
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.12e-23
Family Cold shock DNA-binding domain-like 0.0000371
Further Details:      
 
Domain Number 5 Region: 569-640
Classification Level Classification E-value
Superfamily RuvA domain 2-like 2.05e-19
Family Tex HhH-containing domain-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297561854|ref|YP_003680828.1|
Sequence length 797
Comment Tex-like protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MTTPVTPTIDQRIAEELGVGAHQVTAAVDLLDSGSTVPFIARYRKEATGALDDAQLRALE
ERLRYLRELAERRTAILESIRSQGKLDEALEASIHAADSKARLEDIYLPYKPKRRTKAQI
AREAGLEPLAEGLLADPTQDPQEAAAAYVDPDKEVADVKAALDGARAILVERFAEDADLT
GVLRERLWERGRLGSAVREGKEEAGAKFADYFAFSEPLTQLPSHRVLAMYRGEKEEILTL
TLEPEDAPAENADGTTPRSTYENAIAHHFGIVDRGRPADRWLQDTVRWGWRTRILVRLDI
DVRMRLWQQAEDDGVNVFAANLRDLLLAAPAGSRATLGLDPGLRTGVKVAVTDATGKVVA
TDTVFPHAPRRDWDGAIHSLAGLCAAHGVELVAIGNGTASRETDKLAADLIKRHPELNLT
KVMVSEAGASVYSASAYASEELPDLDVSLRGAASIARRLQDPLAELVKIDPKSIGVGQYQ
HDLAETKLSRSLDAVVEDCVNGVGVDVNTASVPLLTRVSGVTSTLARNIVAHRDANGPFR
TREALRSVPRLGPKAFEQCAGFLRVPGGDDPLDASAVHPEAYPVVRRILDRVGTDLPSLI
GNKDLLSRVRPEEFVDDTFGLPTVTDILAELDKPGRDPRPAFTTATFKEGVEKLQDLTPG
MLLEGVVTNVAAFGAFVDVGVHQDGLVHVSALSYKFVEDPRDVVKPGDIVKVKVQDVDIP
RKRISLTMRLDDEAPARGGRGGREERGDRGGNDRRRGNGGGGGGRRNNGGGRGRDNSGGA
APQGAMAEALRRAGLGK
Download sequence
Identical sequences D7B0T7
WP_013153929.1.70090 WP_013153929.1.87825 gi|297561854|ref|YP_003680828.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]