SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297562611|ref|YP_003681585.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297562611|ref|YP_003681585.1|
Domain Number 1 Region: 403-810
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.86e-87
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.0056
Further Details:      
 
Domain Number 2 Region: 101-335
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 4.89e-53
Family CAT-like 0.00014
Further Details:      
 
Domain Number 3 Region: 868-1077
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.22e-48
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297562611|ref|YP_003681585.1|
Sequence length 1219
Comment 2-oxoglutarate dehydrogenase, E1 subunit [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MSSEASQPLTDFGPNEWLVEELYQKYLNDPNSVDKAWWNFFADYKPAETAGAKGGSGAKA
QGEKAPAASAPKKKPTAPAAPAPSAKPKSKDDKEGKDEALQVKQERLRGAPARTATNMES
SLGLPTATSVRAVPVKLLFDNRIVINNHLRRGRGGKVSFTHLIGYAMVKALKALPEMNHS
YVEVDGKPGVAKPEHVNFGLAIDLQKPDGSRQLVVPSIKKSDEMDFTEFWSGYEDLVRKA
RSNKLGVPDFQGTTISLTNPGGIGTVHSVPRLMPGQGTILGVGAMEYPAEFQGASSDTLA
ELGISKVMTLTSTYDHRIIQGAQSGEFLRRIHQLLLGEDGFYDEIFNSLRIPYEPVRWVQ
DIHVNKATQLDKTTRVQELIHAYRVRGHLMADTNPLDHEQRKHPDLDVLEHGLTLWDLDR
EFPTGGFGGKQVMKLRDVLGVLRDTYCRTVGIEYMHIQSPEEREWIQAHVEREHEKLDRD
EQLHILHRLNSAEAFETFLQTKYVGQKRFSLEGGESLIPLLDGVISKAAKAELDEAVIGM
AHRGRLNVLANICGKSYAQIFGEFEGNLDPRSAHGSGDVKYHLGTEGTFETHDGQKIRIS
LAANPSHLETVDPVAEGIVRAKQDVLNKGPQGFTVLPILIHGDAAFAGQGVVAETLNLSQ
LRGYRTGGTVHVIVNNQVGFTTSPSDSRSSVYATDVARMVQAPIFHVNGDDPEAVVRVAH
LAFAYRQAFNKDVVIDLVCYRRRGHNEGDNPAFTQPLMYDVIDAKRSTRKLFTEALIGRG
DITVEEAESALRDYQSELERAFTETREVEKKPIEPGSVVKPEVFTEGRLEHSAVETAIST
ETVKRVIDTQVSLPEGFTPHPRLAPQLSRRATMVETDAIDWATGELLAFGSLLLDGHPVR
LIGQDSRRGTFGQRHATLMDRETGETHTPLKQFDDGITRFHVHDSLLSEYAALGFEYGYS
LTRPDALVMWEAQFGDFVNGAQTIIDEYISAGEQKWGQRSSVTLLLPHGYEGQGPDHSSA
RIERFLQQCAQENMTVAHPSTPASYFHLLRWQAKSPLERPLVVFTPKSLLRLKAATSAAA
DFTSGHFEPLIKDDSIAPDKVRRVVLCSGKIYYDLDAARRKSGDKHTAIIRAERLYPLPI
EEIREQLKAYPNAGEVLWVQEEPANMGPWPFVALVFSEQLDRPFTRISRPASSAPAAGSA
KRHEAEQRALVDTVFPPAD
Download sequence
Identical sequences D7B558
gi|297562611|ref|YP_003681585.1| WP_013154686.1.70090 WP_013154686.1.87825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]