SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297562785|ref|YP_003681759.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297562785|ref|YP_003681759.1|
Domain Number 1 Region: 160-339
Classification Level Classification E-value
Superfamily PP2C-like 0.0000000000000068
Family PP2C-like 0.013
Further Details:      
 
Domain Number 2 Region: 35-133
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00000000105
Family Histidine kinase 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297562785|ref|YP_003681759.1|
Sequence length 349
Comment anti-sigma regulatory factor, serine/threonine protein kinase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MTRVWDLAVTDATHVSDAARTARKAALGIGLDGAAADAAALAASELATNMCRYAGGGRFV
AEEAREPWGTARALQILALDHGPGIPDVPRAMEDGFSTSEDSLGAGLGACARAADFFEVQ
SAPGRGTVAVARFARPADRALFGARAATGGIHVPLGGYKLSGDALAFRSGGALRTVMLAD
GLGHGEAASEAADVASRFVTGSRGGTPDTLLRGLHEALRRTRGAAVAIVEIDESRGRLTF
CGVGNIGARLYRGGRWETLLSQPGIVGAFSLRTPVPARREWSPGDMLILHSDGVPGRWKP
EGVEALRGHDAAVVAGAVFRDSGSAARPLRDDTSVAVVTHTARPDGGGR
Download sequence
Identical sequences D7B6G6
gi|297562785|ref|YP_003681759.1| WP_013154860.1.70090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]