SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296392795|ref|YP_003657679.1| from Segniliparus rotundus DSM 44985

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296392795|ref|YP_003657679.1|
Domain Number 1 Region: 15-376
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 5.64e-104
Family FMN-linked oxidoreductases 0.000000053
Further Details:      
 
Domain Number 2 Region: 347-532
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 7.42e-43
Family N-terminal domain of adrenodoxin reductase-like 0.00004
Further Details:      
 
Domain Number 3 Region: 476-534,574-671
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.42e-19
Family C-terminal domain of adrenodoxin reductase-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296392795|ref|YP_003657679.1|
Sequence length 693
Comment NADH:flavin oxidoreductase [Segniliparus rotundus DSM 44985]
Sequence
MNTSIRRPAAEQPALPYPNLLSELDLGRTRLKNRVVMGSMHTGYEDYPWMIDKLAAYYGE
RAAGGVGLIVTGGYAPNYLGSTVPLFGQFTTKLVAKSHRKITDAVHEHGAKILLQILHTG
RYAFHPLAVSASATSAPTTPFRAWKMPGWLIRSTIRDYARAAKLAKAAGYDGIEVMGGEG
YLINQFLAPLTNKRTDEWGGTPQKRRRFPVEITRQIRAAVGPDFILQFRISLVDYVPEGQ
TWEEIVALAKELEEAGVDIFNTDIGWHEARVPTIVTSVPSGAFVEYTHALAQQVDVPVIA
SNRINMPEAAEQILAETDVDLISMARPLLADPNWVNKAKAGQSDLINTCIACNQACLDHA
FAHKTVSCLLNPRAGRETQLQLLPTRKAKKVAVVGAGPAGLATAVSLAERGHSVTLIEGD
DRIGGQFLIASKIPGKEEFRHTLRYFQKQLEHHKVQVRLNTRITAAQLSAEGFDDVVVAT
GVAPRMPRIPGVEHPMVLSYADVVKEGKPVGKRVAVIGAGGIGFDVSEFLTTEDSPTLHL
KEWRQEWGVSDPVDPARGGPRGGIVAPKPGPSPREVYLLARTPGPLGRKLGKTSGWVHRA
AIKAKKVVQLSGVNYEKIDDQGLHITFGEEHKDPRVLEVDNVVICAGQESQRGLYDELVA
KGVRAHVVGGALLAGELDAKRAIRQGTELAAAL
Download sequence
Identical sequences D6ZB89
gi|296392795|ref|YP_003657679.1| WP_013137304.1.68606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]