SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296273057|ref|YP_003655688.1| from Arcobacter nitrofigilis DSM 7299

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296273057|ref|YP_003655688.1|
Domain Number 1 Region: 1-51,556-788
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.43e-25
Family ABC transporter ATPase domain-like 0.0062
Further Details:      
 
Domain Number 2 Region: 1-165,193-285
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.15e-24
Family ABC transporter ATPase domain-like 0.0024
Further Details:      
 
Domain Number 3 Region: 360-457
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.00000314
Family Rad50 coiled-coil Zn hook 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296273057|ref|YP_003655688.1|
Sequence length 789
Comment SMC domain-containing protein [Arcobacter nitrofigilis DSM 7299]
Sequence
MILCKLKLENFKRYKTFELDFDEGLVGIIGKNGSGKSTIFEAILFALYGEFKDRGYKEIV
RNANATDKDAVVVELDFEFDSIEYKVVREFRGKALSANAKLYKNGELITSGAKEVTTSIM
KLTKMSKEAFLHTLFASQKELTSLSNSKPEDRKRMIRKLLDLEKIDYIEKELIEKSRELK
REISAFAEVLLSAEDIQTKKEQIKSNEAIKKTLNEELQTQTKQIDSLKLKELDIKKELES
FVKTKEAKQKALSELNLLKNSINSNIENQNKLSTELKDLEEKQLQYKALEPIKKEYETLQ
SNLKEQIQLKEYSLKKEGLIKEQVQLREQYKKAKNDIALLQKECEGFEALKQKEQESKTQ
QEQIKQTLTQIQVKEKELNSNIFAEQRIINDTTAKIQQMQALGKESNCPTCTRPLLEEYD
NVIGSLNSTINEIQTNKITKLNKELQEVETNKKTIETQKEQIDKTLSELNSQLALINSKQ
KDLQNLSSHLNKVEQKGKENNDEIAKLDKYSYDENKHKTLENSFNEIQPKYEQMKSLETM
LKRYDSVKQDLEIISKKITEQNSTYDTKEIDYKQIAYDETAHTSKQKEYEEHHQTYELKV
NQINEIKVKIAQCEGEIKTIQSSLDNNEIQLKKVQTKKDDLIDYDKIKLSLSEFKTKLNS
KVAPRISDIASNMYAQITKGKYQHIEVSNDFDFYIYDEGKKYPIERFSGGEIDLANLVLR
IAISKTLSELSGSSQIGFLAFDEVFGSQDEARRMEILEAFHMIKEQYRQIFLISHEMEIK
EMFEKVVEL
Download sequence
Identical sequences D5V614
WP_013135326.1.41079 gi|296273057|ref|YP_003655688.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]