SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296273453|ref|YP_003656084.1| from Arcobacter nitrofigilis DSM 7299

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296273453|ref|YP_003656084.1|
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.57e-35
Family Sfri0576-like 0.0000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296273453|ref|YP_003656084.1|
Sequence length 126
Comment hypothetical protein [Arcobacter nitrofigilis DSM 7299]
Sequence
MKTKKHELTVGIQKVDSSILLTIKAVGTLTHEDYETITPLIDSALEGVTNPKIRAICDCT
ELEGWELKAAWDDLKIGLKHGNQFEKIAIITGKSWIKIGSKITSWFIQGEVKNFENELEA
FEWLNE
Download sequence
Identical sequences D5V1Z3
gi|296273453|ref|YP_003656084.1| WP_013135722.1.41079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]