SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296274653|ref|YP_003657284.1| from Arcobacter nitrofigilis DSM 7299

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296274653|ref|YP_003657284.1|
Domain Number 1 Region: 395-486
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000141
Family Anti-sigma factor antagonist SpoIIaa 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296274653|ref|YP_003657284.1|
Sequence length 498
Comment sulfate transporter [Arcobacter nitrofigilis DSM 7299]
Sequence
MVKKYFKREEWFSNIRGDTLSGLVVALALIPEAIAFSIIAGVDPKIGLYASFCIAVVISF
VGGRPGMISAATGAMALVMVSLVKDYGLQYLLAATLLTGIFQIIAGYLKLGRFMSFVPRA
VVIGFVNALAILIFMAQLPELTNVTWHVYALTALGLAIIYLFPYVPKIGKIIPSPLVTII
TLTLIVLFLGIDVRTVGDMGELPDTLPIFLFPDIPLNLNTLLIILPYSVSLAVVGLLESL
MTSTIVDELTDTKSEKNRECTGQGIANIASGLLGGMAGCAMIGQSVINIKSGGRTRLSTF
LAGVFLLIMVVFLSDIISVIPMAALVSVMIMVSIGTFDWGSFKNLKTLPLSTNLVMLTTV
CVTVYTHNLAHGVFSGVLLASLFFANKISHFMYNETSYNEDNTIKTYKFVGQVFFNSADK
FYAAFDFKEVLDKVIIDLTRAHFWDISAVNALDKAVIKLRREGAEVEIIGQNEASKTIID
RFGIHDDPEEIEKVMGGH
Download sequence
Identical sequences D5V807
WP_013136921.1.41079 gi|296274653|ref|YP_003657284.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]