SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302343319|ref|YP_003807848.1| from Desulfarculus baarsii DSM 2075

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302343319|ref|YP_003807848.1|
Domain Number 1 Region: 5-278
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.53e-79
Family G proteins 0.00000751
Further Details:      
 
Domain Number 2 Region: 475-595
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.61e-44
Family Translational machinery components 0.000015
Further Details:      
 
Domain Number 3 Region: 599-689
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 8.15e-29
Family EF-G/eEF-2 domains III and V 0.00015
Further Details:      
 
Domain Number 4 Region: 262-396
Classification Level Classification E-value
Superfamily Translation proteins 8.25e-27
Family Elongation factors 0.00064
Further Details:      
 
Domain Number 5 Region: 403-478
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.33e-18
Family EF-G/eEF-2 domains III and V 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302343319|ref|YP_003807848.1|
Sequence length 696
Comment translation elongation factor G [Desulfarculus baarsii DSM 2075]
Sequence
MSDKVNQTRTIALVGHGGAGKTSLAEAMLFNAKAVDRLGKVDEGNTVLDFEPEEIKRGGS
VSASFGHYSHKKHDVHLVDCPGDDNFLFDAASALRAVDGAIMVIDAIDGIKVQGEKVWQF
VQAAQTPALVVVNKMDRERANFDAAVNMIPDMLGVKGVRLQLPIGAADGFGGVVDLLSNK
AYTFAKDGSGKMEIGEIPADMADEVEALRESLIEDIAEADDSLMERYLEGESVSDDELAA
ALKKGVIERLFVPVTACAALRNIGVQSVMDLVNRLLPSPVEAGAVSGVDVKTGEEIQRQP
SADEPFCGLVFKTVADPFAGRLSMVRVFSGKLTSELPLLNPNKDAKERFGQLYLQTGKTQ
KAIAEALPGDIVAIPKLKETATGDTLCEDKSPIKLQPVPPMPAVISYAIEAKEKGDEEKL
FAGINKLLEEDPTLRLDRDPATGEALLGGMGSVHIETTLERLRRKFNVEVNLKTPKVPYR
ETIKGKTKVQGRYKKQTGGRGQFGDTWIEIEPAGEGEGYVFVDAIVGGSIPRQYIPAVEK
GIGEALLQGVLAGYPMVDVKVTLYDGSFHPVDSSEMAFKVAGSMGFKKGAPQCKPTMLEP
IMKLTVTVPDDAMGDVMGDISSRRGRVLGMESKGSLQIISALVPMAEVLGYQPELTSLTG
GRGAFSMEMDHYEEVPGDVQKKIIEAYQATKKEAEN
Download sequence
Identical sequences E1QI61
WP_013258695.1.88723 gi|302343319|ref|YP_003807848.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]