SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302344038|ref|YP_003808567.1| from Desulfarculus baarsii DSM 2075

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302344038|ref|YP_003808567.1|
Domain Number 1 Region: 4-209
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.24e-54
Family G proteins 0.00019
Further Details:      
 
Domain Number 2 Region: 169-291
Classification Level Classification E-value
Superfamily Translation proteins 1.1e-30
Family Elongation factors 0.0021
Further Details:      
 
Domain Number 3 Region: 403-497
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.1e-20
Family EF-G/eEF-2 domains III and V 0.0084
Further Details:      
 
Domain Number 4 Region: 295-373
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 5.4e-18
Family EF-G/eEF-2 domains III and V 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302344038|ref|YP_003808567.1|
Sequence length 602
Comment GTP-binding protein LepA [Desulfarculus baarsii DSM 2075]
Sequence
MADREHTRNFSIIAHIDHGKSTLADRLIQACGAVTDREFQNQLLDNLYLERERGITIKSQ
AITLPYLAKNGQEYELNLIDTPGHVDFTYEVSRALASCEGVLLIVDASQGVEAQTLANMY
LAMEHDLTIVPVINKIDLISADVDATRLQITEDLGLDGDEALAVSAKEGTNIDQVLEAIV
NKLPPPKGQAEAPLQALIFDAQYDPYRGTVIFVRVMEGQLKQGDFIRFMHNGSSYRVEEV
GLFKLRREPAKALRAGQVGYVIAGVKTVSDVDVGDTITNNDHPAPAPLPGFREAKPVVFS
SIYPVATDDYPELAEAIEKLKLNDASLTYQKDYSQALGTGFRCGFLGLLHLEVVQERLER
EFGLSLILTAPSVRYQVYLNDGQHLEIENPALFPDPSTIDYCEEPYVKASILMPDRYIGT
VMQLCLDRRGEGNVMHYPSPGRVELISELPLAEVIYDFYDKLKTVTQGYGSFDYEFIGDR
RTELAKLDILVNGERVDALSMLVFRGGARPRALHAVNKLAETIPRQQFKIAIQGAIGGTI
IARSTINAFRKDVTAKCYGGDVSRKRKLLEKQKAGKKRMKLVGNVPIPQKAFLAVLQSDT
DK
Download sequence
Identical sequences E1QK80
WP_013259412.1.88723 gi|302344038|ref|YP_003808567.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]