SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302344359|ref|YP_003808888.1| from Desulfarculus baarsii DSM 2075

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302344359|ref|YP_003808888.1|
Domain Number 1 Region: 8-281
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2e-105
Family G proteins 0.0000000296
Further Details:      
 
Domain Number 2 Region: 477-596
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-41
Family Translational machinery components 0.0000155
Further Details:      
 
Domain Number 3 Region: 264-400
Classification Level Classification E-value
Superfamily Translation proteins 1.37e-35
Family Elongation factors 0.0000688
Further Details:      
 
Domain Number 4 Region: 601-688
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.29e-30
Family EF-G/eEF-2 domains III and V 0.00023
Further Details:      
 
Domain Number 5 Region: 402-479
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.17e-21
Family EF-G/eEF-2 domains III and V 0.0000494
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302344359|ref|YP_003808888.1|
Sequence length 702
Comment translation elongation factor G [Desulfarculus baarsii DSM 2075]
Sequence
MTAGSKNSAHRNIGLMAHIDAGKTTTTERILFYTGVSHRIGEVHDGSAVMDWMEQEQERG
ITITSAATTCFWKEHRINIIDTPGHVDFTMEVERSLRVLDGVVAVFCAVGGVQPQSETVW
RQADRYGVPRIAFINKMDRIGADHARCVDMIRSRLGARPLLLQLPLGAEDSFAGVVDLVE
NKLIRFGVDGQGMELCVEDVPTEMLAEVEAARQEVVETACEFDDELMASYLDGVEPTPAQ
IKSALRKGVLEMLVVPVLLGSAFKNKGVQPLLDAVVDYLPSPQEVRPAQGEDADGAVVTC
PADDDAPFAALAFKLWSDPYVGHLTFLRVYSGVLRSGDTVYNANKGKTERVGRLLRMHAN
EREEVKQVRAGGIAAAVGLKLTTTGDSLCDKNKQIKLEALHVPEPVVGVAIEPETKAMGE
KLGQALGRIAAEDPSFRVFHDDETNQTIIRGMGELHLEIIVDRLLREFKVAATVGAPQVS
YREAIVGAAQAEGRYVKQSGGRGQYGHVKIEVTPGEPGSGVSFVDRVVGGVIPKEYIRSV
ENGVREACKRGVLAGFPLEDLEIALYDGSYHEVDSSDRAFVIAGSMALKDAARKAGLRLL
EPMMALEVITPDDYMGEVMGDLSGRRGRVRDVDSRPGVQVIKADVPLAEMFGYAGDLRSA
TQGRANFSMEFSHYEPVPAGLAEVVIERVNKLRQSGSRGMAA
Download sequence
Identical sequences E1QKT5
WP_013259732.1.88723 gi|302344359|ref|YP_003808888.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]