SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302344237|ref|YP_003808766.1| from Desulfarculus baarsii DSM 2075

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302344237|ref|YP_003808766.1|
Domain Number 1 Region: 1-258
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.2e-40
Family Phosphate binding protein-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302344237|ref|YP_003808766.1|
Sequence length 286
Comment family 3 extracellular solute-binding protein [Desulfarculus baarsii DSM 2075]
Sequence
MKRIALFGGIGLAMAAALAVGVVGVMPNDSSWELVRDSGVIRIGYAVEAPYAFLAADGQV
TGESPEVAKYVAAKLGLCRVKWRQVEFASLIDELEAGRIDVVAAGMFVTPQRARRVSFSL
PTFQVRPGLLTPRGNPRGLHSYRQALALADIRIATLAGSVEEQALRRMGAAQAQLVTVPD
ALTGRAAVESGAADALALSSPAVRWLAMTGPTGRTEAAEPFHAPRDGETGLGAFAFRKAD
RRLLEAWNAVLADYVGGPQHLALMTRFGFTDAELPRHASDGEQPSR
Download sequence
Identical sequences E1QMC9
gi|302344237|ref|YP_003808766.1| WP_013259611.1.88723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]