SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300714746|ref|YP_003739549.1| from Erwinia billingiae Eb661

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300714746|ref|YP_003739549.1|
Domain Number 1 Region: 68-339
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.64e-90
Family L-arabinose binding protein-like 0.00000409
Further Details:      
 
Domain Number 2 Region: 10-66
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000000103
Family GalR/LacI-like bacterial regulator 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300714746|ref|YP_003739549.1|
Sequence length 345
Comment HTH-type transcriptional repressor [Erwinia billingiae Eb661]
Sequence
MEHNQETTGATMKDVAEEAGVSTATVSRALMNPEKVSAATRKKVEKAVLAVGYSPHAMAR
SAKRSESRTILVIVPDICDPFFSEMIRGIEVVAADQGYLVLIGDCAHQNKQEKSFLNLVM
TRQIDGMVLLGSQVPFDTGIEEQRNLPPMVMANEFAPELELPTVHIDNLTAAFEAVNHLL
KLGHSRIACIAGPQDMPLCQYRLQGYIQALRRNGLAVDPHYIVRGDFTFDAGSRAMKHLM
TLPKPPDALFCHSDIMALGAMSQAKIMGLRVPQDLSLIGFDDIELSRYSDPQLTTVAQPR
FNIGREAMLLLLEQLQGKTVNSGSRLLDFELKIRGSTAPSLREKV
Download sequence
Identical sequences D8MKN3
gi|300714746|ref|YP_003739549.1| WP_013200196.1.47536 WP_013200196.1.56564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]