SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300716814|ref|YP_003741617.1| from Erwinia billingiae Eb661

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300716814|ref|YP_003741617.1|
Domain Number 1 Region: 70-340
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.23e-61
Family L-arabinose binding protein-like 0.0000734
Further Details:      
 
Domain Number 2 Region: 10-68
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 5.35e-16
Family GalR/LacI-like bacterial regulator 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300716814|ref|YP_003741617.1|
Sequence length 345
Comment LacI family transcriptional regulator [Erwinia billingiae Eb661]
Sequence
MSDKPLPPSRVSLEDVALRSGVSTATVSRVLNGSTTVRQSRREAVEQACEELGYVINRAA
RTLASRRSMTIGAVVPTLATETFSRPLATFQQQIHQSGYTMLLANSDFDPDTELKEVNKL
VEYGIDALMLVGNSHHPKLWDRITQQNIPCIQTFSVDQRYPSVGYDNELAAGELTAHLLA
LGHKNFGVIVGTPPSNDRVSDRITGTRQALTAAGLSLDDRNLFNRAFSMNDARLAMFQLL
DSPNPPTAVICGNDLLAFGAMRAAGERYLRIPNDISITGFNDYEYSEHLEHPLTTMRVEL
DEIGVRAAEFLLAELNGETGVRQTILKPELIVRGSTGSAPRVVSK
Download sequence
Identical sequences D8MSG3
gi|300716814|ref|YP_003741617.1| WP_013202257.1.56564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]