SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300716837|ref|YP_003741640.1| from Erwinia billingiae Eb661

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300716837|ref|YP_003741640.1|
Domain Number 1 Region: 72-325
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.3e-42
Family L-arabinose binding protein-like 0.00019
Further Details:      
 
Domain Number 2 Region: 13-72
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.97e-16
Family GalR/LacI-like bacterial regulator 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300716837|ref|YP_003741640.1|
Sequence length 342
Comment LacI family transcriptional regulator [Erwinia billingiae Eb661]
Sequence
MMSEKMPHQPPARKVTASDVAKRAGVSKWTVSRAFTDGASISETAMERVQQAAKDLGYRP
NLLARSLSKRSSHLIGVVVDEMLNPNLLTLLDQVTQQLQLRGYMALLINISAQKSEEAVL
TLADQLQVDGLLFLGTLLSDELIALARDIHRIPLVQLCRNDDNPYIQIINTDGYQAGYQT
ADLLHQQGYRRFSYMKGPDTESTQLLRFEGYRDRLVQLGVAEAGITLLKANHYNRASGYN
AYHHYLTSTPQQAWAEAMFCENDILAIGVLDALASTAPDHHLGIVGYDNIELAGSSRYQL
TTFAQPLSDMLQEAVYRLTAPDSEPRQYQHHDQLQLRRSHLR
Download sequence
Identical sequences D8MSI6
WP_013202280.1.56564 gi|300716837|ref|YP_003741640.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]