SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300717896|ref|YP_003742699.1| from Erwinia billingiae Eb661

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300717896|ref|YP_003742699.1|
Domain Number 1 Region: 26-327
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.36e-64
Family L-arabinose binding protein-like 0.00000735
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300717896|ref|YP_003742699.1|
Sequence length 327
Comment sugar ABC transporter sugar-binding protein [Erwinia billingiae Eb661]
Sequence
MLKRVTLTLLASSVYLVSQLVSAADKPKVAFVPQIVGIPYFQAMQDGGNRAAKELGVDFI
YSGPVDTNPMDQLQIVQNLIAQGVKAISVSVLDASSLAPVVEQAKSRGISLYTSDSDAPD
SGRAVYVAQATDQGLGESIIDEMVKRVGDRGKIGIVSGEATASNLNAWIGFMQARVKAKY
PNVTLLAPQFAGGTASRAAQISTDLMSSNPDLKGIIAVASTTCPGVAQAIETAGKIGKVI
GAGYCSPNTARAYLKSGAFGYSVLWDPEKLGYLTVWAGKELIDGKKFAAENSVPGFAKPV
SYDSKTGILLLGAPAVFTKDNVDQYHF
Download sequence
Identical sequences D8MVJ5
WP_013203337.1.56564 gi|300717896|ref|YP_003742699.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]