SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300718473|ref|YP_003743276.1| from Erwinia billingiae Eb661

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300718473|ref|YP_003743276.1|
Domain Number 1 Region: 70-353
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.45e-57
Family L-arabinose binding protein-like 0.000068
Further Details:      
 
Domain Number 2 Region: 10-69
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000113
Family GalR/LacI-like bacterial regulator 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300718473|ref|YP_003743276.1|
Sequence length 362
Comment LacI family transcriptional regulator [Erwinia billingiae Eb661]
Sequence
MTRAAARAKAPTVADVAREANVSKAQAARALGGYGAVSDEVATRVTDAASRLGYRPNELA
RSMNTGRSNTLGVIVGDIENPHFGLALRGISDVARQAGYHVILSNSDEQVDIEQEAVRVM
LDKRVDGIIVAPCSSAAGDNPHLAQILADGCALTLFDRGVYDLDVEVIGVDFTPAAQEAT
QQLLELGHRRIAYVTSMQCEGGYQQPEDLGLTPVAQRVAGMERAFLQAGVTFLPEMIKTD
AIDDAAIGKIVAQLFENGPPPSAIVASDSLIAQSLMREFALRGLRIPQDLSFVMYDNFPW
TEIVSPPLSVIEQPVYEMGREAARRVISQIRGDDAGSQPTFTPRFIRRGSVGPVSTAGDT
AR
Download sequence
Identical sequences D8MX72
gi|300718473|ref|YP_003743276.1| WP_013203912.1.56564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]