SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300718820|ref|YP_003743623.1| from Erwinia billingiae Eb661

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300718820|ref|YP_003743623.1|
Domain Number 1 Region: 2-187
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.56e-35
Family L-arabinose binding protein-like 0.000000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300718820|ref|YP_003743623.1|
Sequence length 190
Comment high-affinity branched-chain amino acid ABC transporter substrate-binding protein, C-terminal fragment, partial [Erwinia billingiae Eb661]
Sequence
MQASLKKSGGNVVMFEGITAGDKDFSTLVARLKKENVDFVYFGGYYPEMGQMLRQARAAG
LKTQFMGPEGVGNSSLSNIAGAASEGMLVTLPKRYDQVPANKPIVDALKAKKLDSTGPFV
WTTYAALQALTTGMERSKSAEPADIAKNLKEGAAVPTVMGDLNWDEKGDLKGFEFGIFKW
HADGSSTAVK
Download sequence
Identical sequences D8MY69
gi|300718820|ref|YP_003743623.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]