SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300714606|ref|YP_003739409.1| from Erwinia billingiae Eb661

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300714606|ref|YP_003739409.1|
Domain Number 1 Region: 23-292
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.36e-87
Family L-arabinose binding protein-like 0.000000000835
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300714606|ref|YP_003739409.1|
Sequence length 292
Comment D-ribose ABC transporter substrate-binding protein [Erwinia billingiae Eb661]
Sequence
MKMKLTALAVLLGVTVSANALAKDTIALVVSTLNNPFFVSLKDGAQKEADKLGYNLVVLD
SQNNPAKELANVQDLTVRGTKLLLINPTDSDAVGNAVKMANQANIPVITLDRVASQGKVV
SHVASDNRFGGKMAGDYIAKKLGDNAKIIELAGIAGTSAARERGEGFKTAADAHHFQILA
SQPADFDRTKGLNVMQNLLTAHPDVQAVFAQNDEMALGAMRALQTAGKSDVLVVGFDGTA
DGVKAVEGGKLAATVAQQPEQIGVIGVDTADKVLKGQKVQAINPVDLKLVTK
Download sequence
Identical sequences D8MK93
WP_013200058.1.56564 gi|300714606|ref|YP_003739409.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]