SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300715740|ref|YP_003740543.1| from Erwinia billingiae Eb661

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300715740|ref|YP_003740543.1|
Domain Number 1 Region: 41-233
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.000000465
Family L-arabinose binding protein-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300715740|ref|YP_003740543.1|
Sequence length 321
Comment Basic membrane lipoprotein [Erwinia billingiae Eb661]
Sequence
MKMKMMLAFAVSSAISYGPVAHADDSKPRVAALFTQTVSQGSWDMAGYSAFKSMATKDGF
APSYLENTTYESAPAVLRQLASDGVKLVIAHSSGYSAAIKEVAPAFPGTQFVLYSYESTT
ANLPNYSAWSVDWDEYGFVLGVLAASASKSGHIAVISGEPIPSAERTVQFIKKGAAYVNP
KIQVDSAYVGSFTDVARAKEIATGTIARGADFIIPAADTADAGIQQAADDEGVLTIGSYT
DQSKSFPNAIMTSTVMNFDKSYADIGKHFADHQLGNRIITENLATNGWSLKTPFAHVGKD
VETKVFKVIDDLKAGKIKIEE
Download sequence
Identical sequences D8MPD3
WP_013201187.1.56564 gi|300715740|ref|YP_003740543.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]