SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300717683|ref|YP_003742486.1| from Erwinia billingiae Eb661

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300717683|ref|YP_003742486.1|
Domain Number 1 Region: 11-282
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 1.43e-83
Family Folylpolyglutamate synthetase 0.000088
Further Details:      
 
Domain Number 2 Region: 284-411
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 1.44e-35
Family Folylpolyglutamate synthetase, C-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300717683|ref|YP_003742486.1|
Sequence length 420
Comment bifunctional folylpolyglutamate synthase/dihydrofolate synthase [Erwinia billingiae Eb661]
Sequence
MDNLPQATSPLVTWLHYLENLHTQAIELGLTRVHRVATSLDLLTPAPVVFTVAGTNGKGT
TCRTLETLLMAAGYRVGVFSSPHLLRYTERVRIQGEELPEADHTASFADIDAGRGDTSLT
YFEFGTLSALWLFKRAKLDVVILEVGLGGRLDATNIVDADVAVVTSIALDHTDWLGPDRE
SIGREKAGVFRGGKPAVVGEPDMPYTIAEVADSLGAQLVKRGRDWSYTVEEGSWSFTDAQ
GTLSALPLPQVPMPNAATALAALRCSSLQVDDAIIYQWLDKAILPGRFQTVAESPRVILD
VAHNPHAASYLAGRLSELPKSGKVHAVVGMLHDKDIAGTLACLQPEVDYWYCAPLDGPRG
ASAEQLKAHLPTAQTFTSVADAYRQALQQAEAQDIVLVCGSFHTVAQVMETRETENGSGQ
Download sequence
Identical sequences D8MUY2
gi|300717683|ref|YP_003742486.1| WP_013203124.1.56564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]