SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300717695|ref|YP_003742498.1| from Erwinia billingiae Eb661

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300717695|ref|YP_003742498.1|
Domain Number 1 Region: 29-326
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.62e-65
Family L-arabinose binding protein-like 0.0000955
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300717695|ref|YP_003742498.1|
Sequence length 328
Comment ribose ABC transporter substrate-binding protein [Erwinia billingiae Eb661]
Sequence
MKFNVALLNACVVSACMLFTTPSFSAEKHDIAVVAKVTGIPWFTRMEVGVKEAATKLDVN
AYQVGGSTPDPAQQVKVIEDLIAKKVDAIIVVPNDAKVLEPVLKKARDQGIVVLTHESPD
QPIGQWDVETIDSQKYAEKNMDELASAMGGKGGYAIYVGSLTVPLHNAWADAAIKYQKQK
YPDMHEVTSRLPVAESIDKSYATTLDLMRTYPDLKGIIGFGSLGPIGAGQAVKSKRAKNK
IAVVGIAMPAQAAPYLASGDIKKALLWDPKDAGFALVSLADQILDGKQVTPDLTIDGLGK
ADVDMKTHVIRFNRILEVTKDNAKTLGF
Download sequence
Identical sequences D8MUZ4
WP_013203136.1.56564 gi|300717695|ref|YP_003742498.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]