SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300718741|ref|YP_003743544.1| from Erwinia billingiae Eb661

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300718741|ref|YP_003743544.1|
Domain Number 1 Region: 26-232
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0000000000000183
Family L-arabinose binding protein-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300718741|ref|YP_003743544.1|
Sequence length 324
Comment sugar ABC transporter periplasmic sugar-binding protein [Erwinia billingiae Eb661]
Sequence
MLAGAVMLPALAPLLSKRALAADKSIKIALLLPGSVADGGWSMLAYQGLQALKKEGFTVA
WSESVPQAQMEQTIRGYADDGYSLIIGHSFEYGSAFAEVGPDYPDTYFFASTFKPDSKAP
ANVEYVNLAYLQSAYAAGALAALISDKGKAVGFVGGGDNPTQQAMMRAFIAGAEKTRPGV
KGLGVVTGDYDNAAKGREAATTLIGNGADVIWHTADVTGLGALQGAAAAKVKAIGCYADQ
KDVAPAYIACSLKQNLDWMVEEVGHSVASKRFMGGKEWSPTVAKAWSVVYGSEPYNSKLV
SAEAWQTFTAIWQQLDNGSIVPNV
Download sequence
Identical sequences D8MXZ0
gi|300718741|ref|YP_003743544.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]