SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|339482655|ref|YP_004694441.1| from Nitrosomonas sp. Is79A3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339482655|ref|YP_004694441.1|
Domain Number 1 Region: 3-188
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.67e-29
Family UbiE/COQ5-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|339482655|ref|YP_004694441.1|
Sequence length 209
Comment type 11 methyltransferase [Nitrosomonas sp. Is79A3]
Sequence
MDPRIGWMIGFVTGKSVLDLGCVRHSIEETEKPGWLHSEIKKVARRVVGVDYLEQPVLQL
RQKGYEVVCADVEVMQLDEKFDAIVAGDLIEHLNNFGKFIERVKEHLNPDGVFILTTPNP
INPLRFISVLLRGESGANSEHTCWFTEQVIRQLFDRYNFEVIDVRYVDDSYQYYRGWKWI
IFFPINYILVRFRPKFAETLCIAFKLKSS
Download sequence
Identical sequences F8GEB9
WP_013965325.1.5279 gi|339482655|ref|YP_004694441.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]