SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339483595|ref|YP_004695381.1| from Nitrosomonas sp. Is79A3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339483595|ref|YP_004695381.1|
Domain Number 1 Region: 16-202
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.57e-56
Family Methylesterase CheB, C-terminal domain 0.00016
Further Details:      
 
Domain Number 2 Region: 286-479
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.66e-47
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00028
Further Details:      
 
Domain Number 3 Region: 855-967
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.33e-18
Family Heme-binding PAS domain 0.016
Further Details:      
 
Domain Number 4 Region: 215-289
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.00000000000000418
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0076
Further Details:      
 
Weak hits

Sequence:  gi|339483595|ref|YP_004695381.1|
Domain Number - Region: 723-844
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000174
Family Flavin-binding PAS domain 0.052
Further Details:      
 
Domain Number - Region: 565-627
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00401
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.094
Further Details:      
 
Domain Number - Region: 665-747
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.085
Family Extended AAA-ATPase domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|339483595|ref|YP_004695381.1|
Sequence length 973
Comment MCP methyltransferase/methylesterase, CheR/CheB with PAS/PAC sensor [Nitrosomonas sp. Is79A3]
Sequence
MTHQDKVDINPNTETDTFPIVGIGASAGGLNAFTQLLKALPIDTGMAFVLIQHLDPKHIS
LLPDLIKRTTAMPVIEISDNLRVEPNHIYVMPPTHSLALLHGVLQLLPRPDVWGKFLPID
DFLTSLAQDRQNHAIGIILSGTASDGTLGIQAIKTVGGITFAQSEDSAEYDGMPHSAIAS
GHVDFILPPKEIARKLAQIAHHPYLKQQLVKLAEDVPAKETNLGKIFVLLRARTGIDFTY
YKHTTILRRIKRRMMLHQLDEMKDYVKFLRQHPKELDILFQDMLINVTSFFRDPEAFEVL
KKEIFPRLIEQLANERALRIWIPACSTGEEVYSIAIALFEFLGNQVNAMHIQIFASDIDK
QAIDKARQGIYSHHIDETVGIERLARFFIKTTNGYQICKSIRDVCVFAIQNVIQDPPFSR
INLICCRNLLIYLNTPIQKRVLNTFFYALRPNGFLMLGTSETIGSEADLYSLIDRKNKIY
LRKSQANPPNTDLAKILSTSPSVSTFHFHSKDAPPAMQVQQAAENIILTKYGPPAVVIDQ
NMHILYFRGQTGPYIEPTTGSASLNLLKMVHPELIIELRALVHQAIKENNIVRKEGLRMH
HNGSYKNINLQIIPLVSPKTMMPSYLVVFEPGAEIPARQNPLQPEDSCRDARDLRISTLE
NELLTEREYMQSIIEEQEGTNEELQSANEEIQSANEELQSINEELETTKEELQSTNEELT
TIIEEHENRNQELNQVNNDLINLLASIDTPIVILHKNLSIRRFTPAAKVLLNLIDTDTNR
PISNIRPNIAIPDLESELKQVIESAVTKSIEVQDDNGHWYLLRLHPFEKQDKNIDGVVMV
FIDIDAIKDIEQLRNALQYERRLAAVVRDSNDAVTVQDFNGHILAWNQRATEMFGYTEDE
ALQLNANQLIPDIAREEMRTLLEQLQHGQKTPPCETIRCTKEGHLLKVWMTTSILNNGAG
NPAAIAITEREIL
Download sequence
Identical sequences F8GCT1
WP_013966241.1.5279 gi|339483595|ref|YP_004695381.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]