SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339484204|ref|YP_004695990.1| from Nitrosomonas sp. Is79A3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339484204|ref|YP_004695990.1|
Domain Number 1 Region: 1090-1336
Classification Level Classification E-value
Superfamily EAL domain-like 1.44e-90
Family EAL domain 0.0018
Further Details:      
 
Domain Number 2 Region: 918-1076
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.33e-51
Family GGDEF domain 0.00025
Further Details:      
 
Domain Number 3 Region: 34-220
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.7e-50
Family Methylesterase CheB, C-terminal domain 0.00014
Further Details:      
 
Domain Number 4 Region: 303-495
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.4e-47
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00028
Further Details:      
 
Domain Number 5 Region: 680-778
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.63e-26
Family Flavin-binding PAS domain 0.016
Further Details:      
 
Domain Number 6 Region: 237-305
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.000000000000017
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0038
Further Details:      
 
Weak hits

Sequence:  gi|339484204|ref|YP_004695990.1|
Domain Number - Region: 592-674
Classification Level Classification E-value
Superfamily Tropomyosin 0.00719
Family Tropomyosin 0.0094
Further Details:      
 
Domain Number - Region: 778-900
Classification Level Classification E-value
Superfamily GAF domain-like 0.085
Family GAF domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|339484204|ref|YP_004695990.1|
Sequence length 1343
Comment PAS/PAC sensor-containing diguanylate cyclase/phosphodiesterase [Nitrosomonas sp. Is79A3]
Sequence
MSKKEKSKSSESINITNNSTSAEYTRHTKNTSEDTLPVVGIASSAGGVSALKSFFMHAPP
KTGMAFVVIQHLESTFESKLVELLQPGTQMKVIQADNRMEINSNCIYVMPSDRDLTIKDG
ILYLVSRPSQHKLHLPADLFFQALAEDKGESAIGVILSGMGSDGTLGLKAIKKNNGWTFV
QDPISCEFDSMPRNAIDAGYVDDVGLVEELPGMIISRLKHYQLNKPDQNGLDTSKHSSAL
NKILHLIYERTGHEFSQYKKSTLYRRIERRVKECKINSMAAYAQYLHENYQEVDILFKEL
LINVTYFFRDPDVWQYLEEEALPPLLRKHPKGTVLRAWIPACSTGEEAYSLAILFKEAIN
RTKLKNAVLLQIFATDLDAEALNKARKGFYPLTIAENISSARLKRFFIKNKNGYQIKDEV
RELVIFAEHNITKEAPFSKLDLLSCRNLLIYLNRELQENLLPMFHYALNPEGILLLGTAE
TIGRYNDLFHPIDIKLPIYKRTDSSLQSVYLHFPNIKDAYLETIRNKKIFSNKNVKLSPL
LDESQSDDYTPLSLLINKKGEIVYSIKNSNIHSGLNENSALENLSDVTTLESLMTELQIS
REELHAVHEEMQTSQEELRSGNEELRATNEDLHHANENLQLTNQELVDFKKKLLDTNERL
KSTNTELVTYIKAIGELALVSVADRTGKITEANARFCEISEYSKEELIGQNHSILKSGTH
SKAFFVELWKTIAGGNIWHKEICNRTKSGKLYWVDSVIVPLKDTEGRVERYISIRVDISK
RKQKELQLVEQLKEKSCLYAIHRDMVLETSLQKLCSQIIKHLTLAMRFPEIAVCSIKLFQ
EFFTSDNYQSDLSNYISTKIKVSGNVCGRLSVFYTEDKPFILPDEQNLINFIAEDLGIWF
ERRNHEQHINHMASHDVLTGLPNRLLLQDRITKALEFNQRHHGMIAVLFIDLDNFKNIND
TFGHNLGDLLLKKVAERLSASIRSEDTVARQGGDEFIVVLPYLIETNVVDFVAQKILNQL
SEPYFVNEHEFYITCSIGIALYPEHGKEADILLKHSDTAMYHAKSAGRNSFRYFSEEMNL
QAIENHRLTNYLHSAIKGNQLQLFFQPIVDVKNTIISLEILLRWQHAVEGWISPSKFIPL
AEESGLILPLGEWIIKSACLQIKTWENDGFDVPRISINLSAKQFQHKSFFPNIQRILNET
DVTAHHLILEITESLLMKDNDNVIKTLNQLSNLGFMIAIDDFGTGYSSLSYLKHYPINKL
KIDRSFVSDITTDENDAAIVIATIGMAHSLGIEVIAEGVETAAQLAFLNERGCDLFQGFY
FCKPVPASEIVNLLRTKEHSSIY
Download sequence
Identical sequences F8GI50
gi|339484204|ref|YP_004695990.1| WP_013966818.1.5279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]