SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296113738|ref|YP_003627676.1| from Moraxella catarrhalis RH4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296113738|ref|YP_003627676.1|
Domain Number 1 Region: 32-389
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.88e-111
Family FMN-linked oxidoreductases 0.00000000513
Further Details:      
 
Domain Number 2 Region: 361-547
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 7.06e-42
Family N-terminal domain of adrenodoxin reductase-like 0.00004
Further Details:      
 
Domain Number 3 Region: 502-670
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000793
Family C-terminal domain of adrenodoxin reductase-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296113738|ref|YP_003627676.1|
Sequence length 716
Comment 2,4-dienoyl-CoA reductase FadH [Moraxella catarrhalis RH4]
Sequence
MPLPFLKQRLTKIIPTKALSTNPQAPIPNSNYPHLFEPLDLGFTTLKNRVVMGSMHTGLE
DRFYHYGKLATYFEARAKGGVGLIITGGIAPNRTGWLIPAGGTLNRLGDIVHHARITRAV
HKHGAKILLQILHSGRYGYHPFVVAPSPIKSPISPFKPRQMSQNNIQSTIDDYAHTAKLA
KKAGYDGVEIMGSEGYLINQFLSARTNKRTDSYGGSLENRMRFAIEVVRAVRKAAGMDFI
ITFRLSMIELVEDGATMQDVITLAKALELAGVSIINTGIGWHEARIPTIVTSVPRAAFTR
YTAAVKHAINIPVIAANRINMPQTAEEILSSGQADLVQMARPFLADSDWVNKAASNQAHL
INTCIGCNQACLDHTFANQRASCLVNPLACFESEISVKPTKKPKKIIIVGAGVAGLSAAV
TAASRGHQVTIYEQHTHIGGQFNMAKVIPGKEEFFETIRYFREQIKHLNITVHLNTKVDK
AILNQSRADHVIIATGVVPRMLPSLEGANLPQVISYSDLLTGKKIAGERVAVLGAGGIGF
DVAEFLTHGSSVSDAVNDATYKPKAMDVDTFFTHWGVDQQACYQTKGALVEPNYTTPVRQ
VYLLQRSEGKLGKTLNKTTGWVHKAAIKQAGVIQIAGASYDKVTNEGLWITIDGKSQLLR
VDTVVLCIGQESVNDLMPKLGDTPKADYQVIGGAKSSAQLDAKRAIKEGFELAARL
Download sequence
Identical sequences A0A0E1Y968 D5V894
WP_003657716.1.17075 WP_003657716.1.27716 WP_003657716.1.28780 WP_003657716.1.81842 WP_003657716.1.95966 gi|296113738|ref|YP_003627676.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]